| Desktop | 82/100 | ✔ |
| Mobile | 83/100 | ✔ |
| Field | Data | Result |
|---|---|---|
| Page Size | 37 KB | ✔ |
| Compression | NO | ✘ |
| Text/Html Ratio | 3177 / 37761 (bytes) = 8.41% | ❗ |
| Load Time | 1.13 second | ✘ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 19 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | English | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | Yes | ✘ |
| Underscores in url | Yes | ✘ | Images Without ALT | 10 / 16 | ✘ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | No | ✘ |
| Email Privacy | No | ✘ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| custom | 6 | ✔ | ✔ | ✔ |
| kitchen | 5 | ✔ | ✔ | ✔ |
| have | 4 | ✘ | ✘ | ✘ |
| will | 4 | ✘ | ✘ | ✘ |
| cabinetry | 4 | ✘ | ✔ | ✔ |
| want | 3 | ✘ | ✘ | ✘ |
| rhodes | 3 | ✔ | ✔ | ✘ |
| 3 | ✘ | ✘ | ✘ | |
| full | 3 | ✘ | ✘ | ✔ |
| granite | 2 | ✘ | ✔ | ✘ |
| just | 2 | ✘ | ✘ | ✘ |
| every | 2 | ✘ | ✘ | ✔ |
| best | 2 | ✘ | ✘ | ✘ |
| most | 2 | ✘ | ✘ | ✘ |
| stone | 2 | ✘ | ✘ | ✔ |
|
With 1.13 seconds in page load, 37 KB of page size and all other reports below, the masterpiecemarketingagency.com has a SEO score of 51 out of 100 |
| Title | Rhodes Custom Kitchens llc - Home |
| Description | Kitchen Specialists. This is who you call for cabinetry, countertops and anything kitchen related! Custom Cabinetry to Kitchen Remodels. Even Kitchen and Bath how to videos and tools. Granite countertops, woodworking, Rhodes Custom Kitchens LLC, |
| Keyword | cabinetry, stock cabinets, remodeling, Rhodes, Rhodes Custom Kitchens, Custom, cabinets, Master craftsman, WV, woodworking, Fabuwood, cook, Kitchen remodeling, cherry, maple, oak, solid wood, stone, kitchen ideas, contractor, builder, quality, high-end |
| Age | 0 Years, 3 Days |
| Created | 1st-Apr-2020 |
| Updated | 1st-Apr-2020 |
| Expiry | 1st-Apr-2022 |
| Host | Type | Ttl | Other |
|---|---|---|---|
|
No match for M |
| Server IP | 66.96.147.106 |
| Server Location | United States |
| Service Provider | The Endurance International Group |
| Domains (TLD) | Status |
|---|---|
| masterpiecemarketingagency.net | Available |
| masterpiecemarketingagency.org | Available |
| masterpiecemarketingagency.biz | Already Registered |
| masterpiecemarketingagency.io | Already Registered |
| masterpiecemarketingagency.info | Available |
| Domains (TLD) | Status |
|---|---|
| nasterpiecemarketingagency.com | Available |
| hasterpiecemarketingagency.com | Available |
| jasterpiecemarketingagency.com | Available |
| kasterpiecemarketingagency.com | Available |
| lasterpiecemarketingagency.com | Available |
| Brittanybested.com |
| Bristolmillsstorage.com |
| Steam.business |
| Trainfla.com |
| Leenainkorea.com |
| Fujijadeandmythai.com |
| Brightbayconstruction.net |
| Alhidayahciomas.com |
| Botssol.com |
| Woskowijka.com |